Product Added to your Cart
x

-------- OR --------

Default
HebrewSpainJapanCzech RepublicItalyHungaryFranceRomaniaThailandPolandPolandDutchCroatiaGreeceCroatiaVietnameseGermanyFinlandDenmarkSwedenPortugalNorway
GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Menu
0 items
Crystal Corner

Please note: All crystals are handpicked and all pass my quality test, but since they are natural stones there will be some variation in appearance. If you prefer a particular one, please send a message and I’ll do my best to choose for you. The deeper tend to be more opaque; the paler tend to be clearer. You may not receive the item in the photographs.

Sub-Categories
Gemstone A-ZBraceletsHeartsPointsSoapstonesSpheresTumblestonesWorry StonesOther (mostly selenite!)
146 product(s) found for "Crystal Corner"
Amazonite
Amazonite
Amazonite
Amazonite The sone of courage and truth. Empowers self-discovery, truths and integrity. Helps to move beyond fear of judgement and confrontation. Live in alignment. Sincerity, Truth, Alignment, Empowe...
£2.00
Units in Stock: 7
£2.00
Details
Add To Cart
Amazonite The sone of courage and truth. Empowers self-discovery, truths and integrity. Helps to move beyond fear of judgement and confrontation. Live in alignment. Sincerity, Truth, Alignment, Empowe...
Amethyst
Tumblestones
Amethyst
Amethyst, with its calming shades of purple, is a stone that resonates with the energies of peace and tranquility. Each Amethyst Tumblestone is a unique piece of nature's art, showcasing the varying shades...
£1.00
Units in Stock: 18
£1.00
Details
Add To Cart
Amethyst, with its calming shades of purple, is a stone that resonates with the energies of peace and tranquility. Each Amethyst Tumblestone is a unique piece of nature's art, showcasing the varying shades...
Amethyst Chip Bracelet
Amethyst
Amethyst Chip Bracelet
Amethyst Known as the all-round healer. Strong healer and cleaning power. Transforms all negative energy into positivity, love and protection. Activates spiritual awareness. Healer, Cleanser, Negativity...
£3.00
Units in Stock: 9
£3.00
Details
Add To Cart
Amethyst Known as the all-round healer. Strong healer and cleaning power. Transforms all negative energy into positivity, love and protection. Activates spiritual awareness. Healer, Cleanser, Negativity...
Amethyst Heart (40 mm)
Hearts
Amethyst Heart (40 mm)
Approximatly 40 mm in size. Hearts are a symbol of love, these make lovely little gifts: to a loved one, a bridesmaid, for yourself! These are perfect to lay on your body during a moment of pause and reflection....
£7.00
Units in Stock: 1
£7.00
Details
Add To Cart
Approximatly 40 mm in size. Hearts are a symbol of love, these make lovely little gifts: to a loved one, a bridesmaid, for yourself! These are perfect to lay on your body during a moment of pause and reflection....
Amethyst Pendulum
Dowsing
Amethyst Pendulum
Introducing our Amethyst Pendulum a captivating and spiritually charged tool that combines the beauty of amethyst crystal with the ancient art of pendulum divination. Elevate your spiritual practices,...
£7.00
Units in Stock: 3
£7.00
Details
Add To Cart
Introducing our Amethyst Pendulum a captivating and spiritually charged tool that combines the beauty of amethyst crystal with the ancient art of pendulum divination. Elevate your spiritual practices,...
Amethyst Puff Heart (30 mm)
Hearts
Amethyst Puff Heart (30 mm)
Approximatly 30 mm in size. Hearts are a symbol of love, these make lovely little gifts: to a loved one, a bridesmaid, for yourself! These are perfect to lay on your body during a moment of pause and reflection....
£4.00
Units in Stock: 2
£4.00
Details
Add To Cart
Approximatly 30 mm in size. Hearts are a symbol of love, these make lovely little gifts: to a loved one, a bridesmaid, for yourself! These are perfect to lay on your body during a moment of pause and reflection....
Amethyst Runes
Divination
Amethyst Runes
Introducing our exquisite Nordic runes crafted from the enchanting beauty of amethyst and adorned with intricate gold symbols! These captivating divination tools are more than just crystals; they're a...
£20.00
Units in Stock: 0
£20.00
Details
Add To Cart
Introducing our exquisite Nordic runes crafted from the enchanting beauty of amethyst and adorned with intricate gold symbols! These captivating divination tools are more than just crystals; they're a...
Amethyst Sphere (30 mm)
Spheres
Amethyst Sphere (30 mm)
Approximatly 30 mm in size. Spheres represent the symbolic sense of oneness, wholeness, completion, karma and respect for cyclical energies. The smooth surface helps with clear communication and helps...
£8.00
Units in Stock: 1
£8.00
Details
Add To Cart
Approximatly 30 mm in size. Spheres represent the symbolic sense of oneness, wholeness, completion, karma and respect for cyclical energies. The smooth surface helps with clear communication and helps...
Amethyst ThumbStone
Worry Stones
Amethyst ThumbStone
Approximately 50 mm in size. Worry stones are smooth, polished gemstones, usually an oval with thumb sized indentations, used for relaxation or anxiety relief. Rubbing a worry stone can help ease tension...
£5.00
Units in Stock: 0
£5.00
Details
Add To Cart
Approximately 50 mm in size. Worry stones are smooth, polished gemstones, usually an oval with thumb sized indentations, used for relaxation or anxiety relief. Rubbing a worry stone can help ease tension...
Amethyst with Tree of Life P..
Dowsing
Amethyst with Tree of Life P..
Introducing our Amethyst Pendulum with a Tree of Life Chain a beautifully crafted and spiritually enriched tool that combines the calming energy of amethyst with the profound symbolism of the Tree of Life....
£8.00
Units in Stock: 3
£8.00
Details
Add To Cart
Introducing our Amethyst Pendulum with a Tree of Life Chain a beautifully crafted and spiritually enriched tool that combines the calming energy of amethyst with the profound symbolism of the Tree of Life....
Amethyst worry stone
Worry Stones
Amethyst worry stone
Discover serenity and inner peace with our beautifully crafted Amethyst heart-shaped worry stone. This enchanting gemstone, known for its calming and protective properties, is delicately shaped into a...
£5.00
Units in Stock: 0
£5.00
Details
Add To Cart
Discover serenity and inner peace with our beautifully crafted Amethyst heart-shaped worry stone. This enchanting gemstone, known for its calming and protective properties, is delicately shaped into a...
Angel Aura Quartz Sphere
Spheres
Angel Aura Quartz Sphere
Angel aura quartz is bonded with platinum and silver and other trace material it gives us a light blue and silvery iridescence reflecting the of an angels wings. Gives very loving and sweet energy stimulates...
£3.50
Units in Stock: 4
£3.50
Details
Add To Cart
Angel aura quartz is bonded with platinum and silver and other trace material it gives us a light blue and silvery iridescence reflecting the of an angels wings. Gives very loving and sweet energy stimulates...
Angelite
Gemstone A-Z
Angelite
Connect with your higher self and embrace serenity with our beautiful Angelite Thumbstone. This polished crystal, known for its soothing light blue colour, is a powerful tool for spiritual growth, communication,...
£5.00
Units in Stock: 2
£5.00
Details
Add To Cart
Connect with your higher self and embrace serenity with our beautiful Angelite Thumbstone. This polished crystal, known for its soothing light blue colour, is a powerful tool for spiritual growth, communication,...
Aqua Aura Quartz Sphere
Crystal Corner
Aqua Aura Quartz Sphere
Aqua/Blue Aura Quartz has a calm, relaxing effect on the emotional body and is exceptional for releasing negativity and stress, soothing and healing the aura. Enhances one s ability to express emotions...
£3.50
Units in Stock: 3
£3.50
Details
Add To Cart
Aqua/Blue Aura Quartz has a calm, relaxing effect on the emotional body and is exceptional for releasing negativity and stress, soothing and healing the aura. Enhances one s ability to express emotions...
Aura Rose Quartz Sphere
Aura Quartz
Aura Rose Quartz Sphere
Whilst this has very similar properties to rose quartz and or a rose quartz helps with restoring self-confidence and eliminates loneliness. The iridescent sheen comes from platinum and other precious materials...
£3.50
Units in Stock: 4
£3.50
Details
Add To Cart
Whilst this has very similar properties to rose quartz and or a rose quartz helps with restoring self-confidence and eliminates loneliness. The iridescent sheen comes from platinum and other precious materials...
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i