Product Added to your Cart
x

-------- OR --------

Default
HebrewSpainJapanCzech RepublicItalyHungaryFranceRomaniaThailandPolandPolandDutchCroatiaGreeceCroatiaVietnameseGermanyFinlandDenmarkSwedenPortugalNorway
GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Menu
0 items
Crystal Corner

Please note: All crystals are handpicked and all pass my quality test, but since they are natural stones there will be some variation in appearance. If you prefer a particular one, please send a message and I’ll do my best to choose for you. The deeper tend to be more opaque; the paler tend to be clearer. You may not receive the item in the photographs.

Sub-Categories
Gemstone A-ZBraceletsHeartsPointsSoapstonesSpheresTumblestonesWorry StonesOther (mostly selenite!)
146 product(s) found for "Crystal Corner"
Aventurine Bracelet
Aventurine
Aventurine Bracelet
A green aventurine gemstone has always been associated with good luck. Its powerful energy can bring wealth and prosperity to the person who possesses it. It constructs an energy shield around you which...
£2.00
Units in Stock: 9
£2.00
Details
Add To Cart
A green aventurine gemstone has always been associated with good luck. Its powerful energy can bring wealth and prosperity to the person who possesses it. It constructs an energy shield around you which...
Aventurine thumbstone
Worry Stones
Aventurine thumbstone
Unlock the power of positivity and prosperity with our beautifully crafted Aventurine thumbstone. This smooth, oval-shaped stone is designed to fit perfectly in the curve of your thumb, making it an ideal...
£5.00
Units in Stock: 2
£5.00
Details
Add To Cart
Unlock the power of positivity and prosperity with our beautifully crafted Aventurine thumbstone. This smooth, oval-shaped stone is designed to fit perfectly in the curve of your thumb, making it an ideal...
Black Obsidian Chip Bracelet
Obsidian
Black Obsidian Chip Bracelet
Obsidian A strong protective stone, shields against negativity and seeks out truth within. Stimulates growth on all levels, encouraging exploration of the unknown, opening horizons. Grounding, Protection,...
£2.00
Units in Stock: 9
£2.00
Details
Add To Cart
Obsidian A strong protective stone, shields against negativity and seeks out truth within. Stimulates growth on all levels, encouraging exploration of the unknown, opening horizons. Grounding, Protection,...
Black Obsidian Sphere
Spheres
Black Obsidian Sphere
Approximatly 20 mm in size. Spheres represent the symbolic sense of oneness, wholeness, completion, karma and respect for cyclical energies. The smooth surface helps with clear communication and helps...
£4.00
Units in Stock: 3
£4.00
Details
Add To Cart
Approximatly 20 mm in size. Spheres represent the symbolic sense of oneness, wholeness, completion, karma and respect for cyclical energies. The smooth surface helps with clear communication and helps...
Black Onyx
Onyx
Black Onyx
This stone has been used as protection for thousands of years and is still one of the strongest protection stones we know of. Onyx Imparts Self-confidence, helping you with your surroundings. Helps with...
£1.00
Units in Stock: 20
£1.00
Details
Add To Cart
This stone has been used as protection for thousands of years and is still one of the strongest protection stones we know of. Onyx Imparts Self-confidence, helping you with your surroundings. Helps with...
Bloodstone Puff Heart
Hearts
Bloodstone Puff Heart
Approximatly 30 mm in size. Hearts are a symbol of love, these make lovely little gifts. These are perfect to lay on your body during a moment of pause and reflection. can use in a crystal grid! Bloodstone...
£4.00
Units in Stock: 2
£4.00
Details
Add To Cart
Approximatly 30 mm in size. Hearts are a symbol of love, these make lovely little gifts. These are perfect to lay on your body during a moment of pause and reflection. can use in a crystal grid! Bloodstone...
Bloodstone Worry Stone
Worry Stones
Bloodstone Worry Stone
Approximatly 40 mm in size. Worry stones are smooth, polished gemstones, usually an oval with thumb sized indentations, used for relaxation or anxiety relief. Rubbing a worry stone can help releve tension...
£4.50
Units in Stock: 3
£4.50
Details
Add To Cart
Approximatly 40 mm in size. Worry stones are smooth, polished gemstones, usually an oval with thumb sized indentations, used for relaxation or anxiety relief. Rubbing a worry stone can help releve tension...
Blue and Yellow Aura Shard
Points
Blue and Yellow Aura Shard
These crystals go beyond mere aesthetics they are believed to carry the energetic properties associated with the colors yellow and blue. Yellow is often associated with creativity, positivity, and abundance,...
£1.50
Units in Stock: 1
£1.50
Details
Add To Cart
These crystals go beyond mere aesthetics they are believed to carry the energetic properties associated with the colors yellow and blue. Yellow is often associated with creativity, positivity, and abundance,...
Blue Howlite Chip Bracelet
Howlite
Blue Howlite Chip Bracelet
Blue Howlite A calming stone, calms stress and anxiety. Encourages communication, awareness and emotional expression. Stimulates a desire for knowledge. Teaches patience and helps calm down rage, pain...
£2.00
Units in Stock: 9
£2.00
Details
Add To Cart
Blue Howlite A calming stone, calms stress and anxiety. Encourages communication, awareness and emotional expression. Stimulates a desire for knowledge. Teaches patience and helps calm down rage, pain...
Blue howlite thumbstone
Howlite
Blue howlite thumbstone
Experience the serene and soothing energy of our Blue Howlite thumbstone. Expertly polished into a smooth, ergonomic shape, this thumbstone is designed to fit comfortably in the palm of your hand, providing...
£5.00
Units in Stock: 2
£5.00
Details
Add To Cart
Experience the serene and soothing energy of our Blue Howlite thumbstone. Expertly polished into a smooth, ergonomic shape, this thumbstone is designed to fit comfortably in the palm of your hand, providing...
Botswana Agate
Tumblestones
Botswana Agate
Selecting 'Quantity: 1', you will be reciveing 1 of these crystals with an organsa bag, your order will be paged and delievered in plenty of protection! Botswana Agate It s protective, warm encouraging...
£1.50
Units in Stock: 6
£1.50
Details
Add To Cart
Selecting 'Quantity: 1', you will be reciveing 1 of these crystals with an organsa bag, your order will be paged and delievered in plenty of protection! Botswana Agate It s protective, warm encouraging...
Carnelian
Carnelian
Carnelian
These tumblestones are larger than my other crystals! some include a little 'geode' pocket (in picutre). Carnelian Stabilises! Restores vitality and motivation. Stimulates creativity. Positive life choices...
£3.50
Units in Stock: 3
£3.50
Details
Add To Cart
These tumblestones are larger than my other crystals! some include a little 'geode' pocket (in picutre). Carnelian Stabilises! Restores vitality and motivation. Stimulates creativity. Positive life choices...
Carnelian Chip Bracelet
Bracelets
Carnelian Chip Bracelet
Amazing bracelets and bangles with your favourite healing crystals, a great way to get the benefits of your crystals all day Carnelian Stabilises! Restores vitality and motivation. Stimulates creativity....
£3.00
Units in Stock: 1
£3.00
Details
Add To Cart
Amazing bracelets and bangles with your favourite healing crystals, a great way to get the benefits of your crystals all day Carnelian Stabilises! Restores vitality and motivation. Stimulates creativity....
Carnelian Pendulum
Pendulums
Carnelian Pendulum
Elevate your divination practice and personal empowerment with our stunning Carnelian pendulum. This exquisitely crafted pendulum features a vibrant, fiery orange-red Carnelian gemstone, known for its...
£7.00
Units in Stock: 0
£7.00
Details
Add To Cart
Elevate your divination practice and personal empowerment with our stunning Carnelian pendulum. This exquisitely crafted pendulum features a vibrant, fiery orange-red Carnelian gemstone, known for its...
Carnelian 'thumbstone'
Worry Stones
Carnelian 'thumbstone'
Was advised as a thumbstone/worry stone, however no dip in the crystal... seems to be more of a plam stone! Embrace the invigorating energy of our Carnelian palmstone, a beautifully polished gemstone designed...
£6.00
Units in Stock: 1
£6.00
Details
Add To Cart
Was advised as a thumbstone/worry stone, however no dip in the crystal... seems to be more of a plam stone! Embrace the invigorating energy of our Carnelian palmstone, a beautifully polished gemstone designed...
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i