Product Added to your Cart
x

-------- OR --------

Default
HebrewSpainJapanCzech RepublicItalyHungaryFranceRomaniaThailandPolandPolandDutchCroatiaGreeceCroatiaVietnameseGermanyFinlandDenmarkSwedenPortugalNorway
GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Menu
0 items
Crystal Corner

Please note: All crystals are handpicked and all pass my quality test, but since they are natural stones there will be some variation in appearance. If you prefer a particular one, please send a message and I’ll do my best to choose for you. The deeper tend to be more opaque; the paler tend to be clearer. You may not receive the item in the photographs.

Sub-Categories
Gemstone A-ZBraceletsHeartsPointsSoapstonesSpheresTumblestonesWorry StonesOther (mostly selenite!)
146 product(s) found for "Crystal Corner"
Howlite Pendulum
Pendulums
Howlite Pendulum
As a stone associated with emotional balance and spiritual awareness, Howlite Pendulums also make thoughtful gifts for friends, family, or anyone seeking a touch of serenity and guidance in their spiritual...
£7.00
Units in Stock: 0
£7.00
Details
Add To Cart
As a stone associated with emotional balance and spiritual awareness, Howlite Pendulums also make thoughtful gifts for friends, family, or anyone seeking a touch of serenity and guidance in their spiritual...
Howlite ThumbStone
Worry Stones
Howlite ThumbStone
Approximatly 40 mm in size. Worry stones are smooth, polished gemstones, usually an oval with thumb sized indentations, used for relaxation or anxiety relief. Rubbing a worry stone can help releve tension...
£5.00
Units in Stock: 2
£5.00
Details
Add To Cart
Approximatly 40 mm in size. Worry stones are smooth, polished gemstones, usually an oval with thumb sized indentations, used for relaxation or anxiety relief. Rubbing a worry stone can help releve tension...
Howlite thumbstone (small)
Howlite
Howlite thumbstone (small)
Discover tranquility with our White Howlite thumbstone, a beautifully polished gem designed for soothing comfort and mental clarity. Shaped to fit seamlessly in the palm of your hand, this thumbstone is...
£4.00
Units in Stock: 1
£4.00
Details
Add To Cart
Discover tranquility with our White Howlite thumbstone, a beautifully polished gem designed for soothing comfort and mental clarity. Shaped to fit seamlessly in the palm of your hand, this thumbstone is...
Jasper Soapstone
Soapstones
Jasper Soapstone
Invite the grounding and nurturing energy of Jasper into your life with our beautifully polished Jasper Soapstone. Known for its rich, earthy tones and powerful metaphysical properties, this soapstone...
£8.00
Units in Stock: 1
£8.00
Details
Add To Cart
Invite the grounding and nurturing energy of Jasper into your life with our beautifully polished Jasper Soapstone. Known for its rich, earthy tones and powerful metaphysical properties, this soapstone...
Labradorite Chip Bracelet
Bracelets
Labradorite Chip Bracelet
Labradorite Is a stone of transformation, useful for times of change! It balances and protects the aura, raising consciousness and grounds spiritual energies. Calms an overactive mind, bringing new ideas....
£3.00
Units in Stock: 8
£3.00
Details
Add To Cart
Labradorite Is a stone of transformation, useful for times of change! It balances and protects the aura, raising consciousness and grounds spiritual energies. Calms an overactive mind, bringing new ideas....
Labradorite Heart (30 mm)
Hearts
Labradorite Heart (30 mm)
Approximatly 30 mm in size. Hearts are a symbol of love, these make lovely little gifts: to a loved one, a bridesmaid, for yourself! These are perfect to lay on your body during a moment of pause and reflection....
£4.00
Units in Stock: 4
£4.00
Details
Add To Cart
Approximatly 30 mm in size. Hearts are a symbol of love, these make lovely little gifts: to a loved one, a bridesmaid, for yourself! These are perfect to lay on your body during a moment of pause and reflection....
Labradorite Point
Points
Labradorite Point
Born from the storms of the Northern Lights and found in Canada s Labrador region, the healing properties of this healing crystal are all about tapping into your own wonderful well of creativity and connecting...
£10.00
Units in Stock: 0
£10.00
Details
Add To Cart
Born from the storms of the Northern Lights and found in Canada s Labrador region, the healing properties of this healing crystal are all about tapping into your own wonderful well of creativity and connecting...
Labradorite Soapstone
Soapstones
Labradorite Soapstone
Labradorite, renowned for its iridescent play of colors, is a stone that resonates with transformative energy. Each soapstone crystal is carefully carved to reveal the mesmerizing hues and unique patterns...
£4.50
Units in Stock: 1
£4.50
Details
Add To Cart
Labradorite, renowned for its iridescent play of colors, is a stone that resonates with transformative energy. Each soapstone crystal is carefully carved to reveal the mesmerizing hues and unique patterns...
Labradorite ThumbStone
Worry Stones
Labradorite ThumbStone
Approximately 50 mm in size. Worry stones are smooth, polished gemstones, usually an oval with thumb sized indentations, used for relaxation or anxiety relief. Rubbing a worry stone can help ease tension...
£5.00
Units in Stock: 2
£5.00
Details
Add To Cart
Approximately 50 mm in size. Worry stones are smooth, polished gemstones, usually an oval with thumb sized indentations, used for relaxation or anxiety relief. Rubbing a worry stone can help ease tension...
Labradorite Worry Stone
Worry Stones
Labradorite Worry Stone
Approximatly 40 mm in size. Worry stones are smooth, polished gemstones, usually an oval with thumb sized indentations, used for relaxation or anxiety relief. Rubbing a worry stone can help releve tension...
£4.50
Units in Stock: 3
£4.50
Details
Add To Cart
Approximatly 40 mm in size. Worry stones are smooth, polished gemstones, usually an oval with thumb sized indentations, used for relaxation or anxiety relief. Rubbing a worry stone can help releve tension...
Large Rose Quartz Soapstone
Rose Quartz
Large Rose Quartz Soapstone
Embrace the gentle, loving energy of our Rose Quartz Soapstone, a beautifully polished stone renowned for its soft pink hue and powerful metaphysical properties. Whether used in meditation, as a calming...
£10.00
Units in Stock: 1
£10.00
Details
Add To Cart
Embrace the gentle, loving energy of our Rose Quartz Soapstone, a beautifully polished stone renowned for its soft pink hue and powerful metaphysical properties. Whether used in meditation, as a calming...
Lepidolite Point
Points
Lepidolite Point
As a stone associated with emotional healing and spiritual insight, this Lepidolite Point also makes a thoughtful gift for crystal enthusiasts, friends, or loved ones navigating times of stress or seeking...
£9.00
Units in Stock: 2
£9.00
Details
Add To Cart
As a stone associated with emotional healing and spiritual insight, this Lepidolite Point also makes a thoughtful gift for crystal enthusiasts, friends, or loved ones navigating times of stress or seeking...
Mahogany jasper worry stone
Jasper
Mahogany jasper worry stone
Ground yourself in the nurturing and protective energy of our Mahogany Jasper Heart-Shaped Worry Stone. Carved into a smooth heart shape, this beautiful stone is designed to bring strength, stability,...
£5.00
Units in Stock: 1
£5.00
Details
Add To Cart
Ground yourself in the nurturing and protective energy of our Mahogany Jasper Heart-Shaped Worry Stone. Carved into a smooth heart shape, this beautiful stone is designed to bring strength, stability,...
Malachite
Malachite
Malachite
Malachite Can clear and activate the chakras and attunes to spiritual guidance. It opens the heart to unconditional love. Breaks unwanted ties and outworn patterns, teaches lessons on taking responcibility...
£2.00
Units in Stock: 3
£2.00
Details
Add To Cart
Malachite Can clear and activate the chakras and attunes to spiritual guidance. It opens the heart to unconditional love. Breaks unwanted ties and outworn patterns, teaches lessons on taking responcibility...
Mini Quartz Point
Crystal Corner
Mini Quartz Point
Elevate your spiritual journey with the metaphysical marvel of a small Quartz generator point crystal. Revered throughout the ages for its extraordinary properties, this crystal serves as a conduit for...
£1.50
Units in Stock: 2
£1.50
Details
Add To Cart
Elevate your spiritual journey with the metaphysical marvel of a small Quartz generator point crystal. Revered throughout the ages for its extraordinary properties, this crystal serves as a conduit for...
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i