Product Added to your Cart
x

-------- OR --------

Default
HebrewSpainJapanCzech RepublicItalyHungaryFranceRomaniaThailandPolandPolandDutchCroatiaGreeceCroatiaVietnameseGermanyFinlandDenmarkSwedenPortugalNorway
GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Menu
0 items
Crystal Corner

Please note: All crystals are handpicked and all pass my quality test, but since they are natural stones there will be some variation in appearance. If you prefer a particular one, please send a message and I’ll do my best to choose for you. The deeper tend to be more opaque; the paler tend to be clearer. You may not receive the item in the photographs.

Sub-Categories
Gemstone A-ZBraceletsHeartsPointsSoapstonesSpheresTumblestonesWorry StonesOther (mostly selenite!)
146 product(s) found for "Crystal Corner"
Chakra Bracelet
Chakra
Chakra Bracelet
Stones: Aventurine, Citrine, Carnelian, Clear Quartz, Hematite, Amethyst, Sodalite. In Sanskrit, the word chakra means disk or wheel and refers to the energy centers in your body. These wheels or disks...
£3.00
Units in Stock: 9
£3.00
Details
Add To Cart
Stones: Aventurine, Citrine, Carnelian, Clear Quartz, Hematite, Amethyst, Sodalite. In Sanskrit, the word chakra means disk or wheel and refers to the energy centers in your body. These wheels or disks...
Chakra Crystal Set
Tumblestones
Chakra Crystal Set
Set of 7 crystals, each elevates 1 of the 7 chakras, spread throughout the body. Comes with a chakra guide, organza bag and pictures to identify and use crystals. Opt to have the 'flower of life' Crystal...
£10.00
Units in Stock: 12
£10.00
Details
Add To Cart
Set of 7 crystals, each elevates 1 of the 7 chakras, spread throughout the body. Comes with a chakra guide, organza bag and pictures to identify and use crystals. Opt to have the 'flower of life' Crystal...
Chakra Pendulum
Chakra
Chakra Pendulum
Introducing our Chakra Banded Pendulum a harmonious and spiritually charged tool that unites the vibrant energy of chakra stones with the ancient art of pendulum divination. Elevate your spiritual practices,...
£7.00
Units in Stock: 0
£7.00
Details
Add To Cart
Introducing our Chakra Banded Pendulum a harmonious and spiritually charged tool that unites the vibrant energy of chakra stones with the ancient art of pendulum divination. Elevate your spiritual practices,...
Chevron amethyst
Tumblestones
Chevron amethyst
Introducing our Chevron Amethyst Tumblestones mesmerizing gems that blend the soothing energy of amethyst with the dynamic patterns of chevron. Mined from the depths of the earth, these polished stones...
£2.00
Units in Stock: 6
£2.00
Details
Add To Cart
Introducing our Chevron Amethyst Tumblestones mesmerizing gems that blend the soothing energy of amethyst with the dynamic patterns of chevron. Mined from the depths of the earth, these polished stones...
Chevron Amethyst Point
Points
Chevron Amethyst Point
Amethyst is often associated with enhanced intuition and connection to higher realms, making this Chevron Amethyst Tower an ideal companion for those on a spiritual journey. Its regal appearance and soothing...
£8.50
Units in Stock: 2
£8.50
Details
Add To Cart
Amethyst is often associated with enhanced intuition and connection to higher realms, making this Chevron Amethyst Tower an ideal companion for those on a spiritual journey. Its regal appearance and soothing...
Citrine
Tumblestones
Citrine
Citrine, with its golden hues, is a stone that resonates with the energies of joy and abundance. Each Citrine Tumblestone is a unique piece of nature's art, showcasing the warm tones and inherent beauty...
£2.00
Units in Stock: 17
£2.00
Details
Add To Cart
Citrine, with its golden hues, is a stone that resonates with the energies of joy and abundance. Each Citrine Tumblestone is a unique piece of nature's art, showcasing the warm tones and inherent beauty...
Citrine 0.2
Tumblestones
Citrine 0.2
Citrine, with its golden hues, is a stone that resonates with the energies of joy and prosperity. Each Citrine Tumblestone is a unique piece of nature's art, showcasing the warm tones and inherent beauty...
£2.00
Units in Stock: 8
£2.00
Details
Add To Cart
Citrine, with its golden hues, is a stone that resonates with the energies of joy and prosperity. Each Citrine Tumblestone is a unique piece of nature's art, showcasing the warm tones and inherent beauty...
Citrine Chip Bracelet
Citrine
Citrine Chip Bracelet
Amazing bracelets and bangles with your favourite healing crystals, a great way to get the benefits of your crystals all day Citrine Attracts happiness, balances emotions, brings wealth and a clear mind....
£4.00
Units in Stock: 0
£4.00
Details
Add To Cart
Amazing bracelets and bangles with your favourite healing crystals, a great way to get the benefits of your crystals all day Citrine Attracts happiness, balances emotions, brings wealth and a clear mind....
Clear Quartz
Clear Quartz
Clear Quartz
Incorporate Clear Quartz into your daily life to amplify the energy around you and invite a sense of purity and clarity. Whether you're a seasoned crystal enthusiast or new to the world of healing stones,...
£1.00
Units in Stock: 18
£1.00
Details
Add To Cart
Incorporate Clear Quartz into your daily life to amplify the energy around you and invite a sense of purity and clarity. Whether you're a seasoned crystal enthusiast or new to the world of healing stones,...
Clear Quartz Pendulum
Clear Quartz
Clear Quartz Pendulum
Introducing our Clear Quartz Pendulum a finely crafted and spiritually potent tool that marries the clarity and purity of clear quartz with the ancient art of pendulum divination. Elevate your spiritual...
£7.00
Units in Stock: 2
£7.00
Details
Add To Cart
Introducing our Clear Quartz Pendulum a finely crafted and spiritually potent tool that marries the clarity and purity of clear quartz with the ancient art of pendulum divination. Elevate your spiritual...
Clear Quartz Soapstone
Clear Quartz
Clear Quartz Soapstone
Elevate your spiritual practice and bring balance and harmony into your life with our Clear Quartz Soapstone. Whether you use it for meditation, energy work, or simply as a beautiful addition to your space,...
£8.00
Units in Stock: 1
£8.00
Details
Add To Cart
Elevate your spiritual practice and bring balance and harmony into your life with our Clear Quartz Soapstone. Whether you use it for meditation, energy work, or simply as a beautiful addition to your space,...
Clear Quartz with Tree of Life
Clear Quartz
Clear Quartz with Tree of Life
Introducing our Quartz Pendulum with a Tree of Life Chain a mesmerizing and spiritually charged accessory that seamlessly blends the power of quartz crystal with the symbolic depth of the Tree of Life....
£8.00
Units in Stock: 3
£8.00
Details
Add To Cart
Introducing our Quartz Pendulum with a Tree of Life Chain a mesmerizing and spiritually charged accessory that seamlessly blends the power of quartz crystal with the symbolic depth of the Tree of Life....
Cotton Candy Aura Shard
Points
Cotton Candy Aura Shard
Beyond its vibrant aesthetics, the Cotton Candy Aura Shard Crystal is believed to carry the energetic properties associated with the aura treatment process. This includes enhanced positivity, soothing...
£2.00
Units in Stock: 2
£2.00
Details
Add To Cart
Beyond its vibrant aesthetics, the Cotton Candy Aura Shard Crystal is believed to carry the energetic properties associated with the aura treatment process. This includes enhanced positivity, soothing...
Crazy Lace Agate
Tumblestones
Crazy Lace Agate
Crazy Lace Agate, known for its intricate and colorful banding patterns, is a stone that resonates with the energies of laughter and positive vibes. Each tumblestone is a unique work of nature's art, displaying...
£1.50
Units in Stock: 8
£1.50
Details
Add To Cart
Crazy Lace Agate, known for its intricate and colorful banding patterns, is a stone that resonates with the energies of laughter and positive vibes. Each tumblestone is a unique work of nature's art, displaying...
Crazy Lace ThumbStone
Worry Stones
Crazy Lace ThumbStone
Approximately 50 mm in size. Worry stones are smooth, polished gemstones, usually an oval with thumb sized indentations, used for relaxation or anxiety relief. Rubbing a worry stone can help ease tension...
£5.00
Units in Stock: 2
£5.00
Details
Add To Cart
Approximately 50 mm in size. Worry stones are smooth, polished gemstones, usually an oval with thumb sized indentations, used for relaxation or anxiety relief. Rubbing a worry stone can help ease tension...
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i