Product Added to your Cart
x

-------- OR --------

Default
HebrewSpainJapanCzech RepublicItalyHungaryFranceRomaniaThailandPolandPolandDutchCroatiaGreeceCroatiaVietnameseGermanyFinlandDenmarkSwedenPortugalNorway
GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Menu
0 items
Crystal Corner

Please note: All crystals are handpicked and all pass my quality test, but since they are natural stones there will be some variation in appearance. If you prefer a particular one, please send a message and I’ll do my best to choose for you. The deeper tend to be more opaque; the paler tend to be clearer. You may not receive the item in the photographs.

Sub-Categories
Gemstone A-ZBraceletsHeartsPointsSoapstonesSpheresTumblestonesWorry StonesOther (mostly selenite!)
146 product(s) found for "Crystal Corner"
Dalmatian Jasper Thumbsone
Jasper
Dalmatian Jasper Thumbsone
Bring a touch of joy and grounding energy into your life with our Dalmatian Jasper Thumbstone. This beautifully polished stone, featuring its distinctive black and brown spots, is designed for comfort...
£5.00
Units in Stock: 1
£5.00
Details
Add To Cart
Bring a touch of joy and grounding energy into your life with our Dalmatian Jasper Thumbstone. This beautifully polished stone, featuring its distinctive black and brown spots, is designed for comfort...
Dragons Bloodstone
Bloodstone
Dragons Bloodstone
Tap into ancient strength and vibrant energy with our Dragon's Bloodstone worry stone. This uniquely patterned stone, named for its striking mix of deep green and blood-red hues, is crafted into a smooth,...
£5.00
Units in Stock: 1
£5.00
Details
Add To Cart
Tap into ancient strength and vibrant energy with our Dragon's Bloodstone worry stone. This uniquely patterned stone, named for its striking mix of deep green and blood-red hues, is crafted into a smooth,...
Feldspar
Worry Stones
Feldspar
Discover the beauty and energy of our Feldspar Thumbstone, a beautifully polished crystal known for its unique range of colours and powerful metaphysical properties. This thumbstone is not only a tactile...
£4.00
Units in Stock: 1
£4.00
Details
Add To Cart
Discover the beauty and energy of our Feldspar Thumbstone, a beautifully polished crystal known for its unique range of colours and powerful metaphysical properties. This thumbstone is not only a tactile...
Flower Agate
Tumblestones
Flower Agate
Flower Agate, named for its captivating patterns resembling blooming flowers, is a stone that resonates with the energies of renewal and growth. Each tumblestone is a unique work of art, showcasing vibrant...
£2.00
Units in Stock: 8
£2.00
Details
Add To Cart
Flower Agate, named for its captivating patterns resembling blooming flowers, is a stone that resonates with the energies of renewal and growth. Each tumblestone is a unique work of art, showcasing vibrant...
Flower Agate Point
Points
Flower Agate Point
Crystal tower generators concentrate their energy in one specific direction, amplify energies, aid in setting and manifesting intentions. Wherever crystal towers are placed, they emit and focus their energies...
£12.00
Units in Stock: 2
£12.00
Details
Add To Cart
Crystal tower generators concentrate their energy in one specific direction, amplify energies, aid in setting and manifesting intentions. Wherever crystal towers are placed, they emit and focus their energies...
Fluorite
Fluorite
Fluorite
Fluorite comes in many colours. will help with: Learning, Relationships, energy, healing and grounding. Fluorite is also said to be aligned with the astrological signs of Pisces and Capricorn. Pisces may...
£1.50
Units in Stock: 7
£1.50
Details
Add To Cart
Fluorite comes in many colours. will help with: Learning, Relationships, energy, healing and grounding. Fluorite is also said to be aligned with the astrological signs of Pisces and Capricorn. Pisces may...
Garnet in Limestone Pendulum
Garnet in Limestone
Garnet in Limestone Pendulum
Garnet in Limestone Helps with purification, strength, courage and positive thoughts. Use for centring and grounding, giving time to go further into our spiritual life. Excellent for manifestation. Strength,...
£8.00
Units in Stock: 0
£8.00
Details
Add To Cart
Garnet in Limestone Helps with purification, strength, courage and positive thoughts. Use for centring and grounding, giving time to go further into our spiritual life. Excellent for manifestation. Strength,...
Garnet in Limestone ThumbStone
Garnet in Limestone
Garnet in Limestone ThumbStone
Approximately 50 mm in size. Worry stones are smooth, polished gemstones, usually an oval with thumb sized indentations, used for relaxation or anxiety relief. Rubbing a worry stone can help ease tension...
£5.00
Units in Stock: 2
£5.00
Details
Add To Cart
Approximately 50 mm in size. Worry stones are smooth, polished gemstones, usually an oval with thumb sized indentations, used for relaxation or anxiety relief. Rubbing a worry stone can help ease tension...
Golden Healer Pendulum
Pendulums
Golden Healer Pendulum
Also Known As Hematoid Quartz A gorgeous form of quartz with red/orange inclusions, which come from iron and haematite. Golden Healer crystals project very powerful healing energy. Golden Healer Quartz...
£7.00
Units in Stock: 1
£7.00
Details
Add To Cart
Also Known As Hematoid Quartz A gorgeous form of quartz with red/orange inclusions, which come from iron and haematite. Golden Healer crystals project very powerful healing energy. Golden Healer Quartz...
Green Aventurine
Tumblestones
Green Aventurine
Quantity 1 = 1 crystal Aventurine is a stone of prosperity. It reinforces leadership qualities and decisiveness. Promotes compassion and empathy. Encourages perseverance. Aventurine relieves stammers and...
£1.50
Units in Stock: 17
£1.50
Details
Add To Cart
Quantity 1 = 1 crystal Aventurine is a stone of prosperity. It reinforces leadership qualities and decisiveness. Promotes compassion and empathy. Encourages perseverance. Aventurine relieves stammers and...
Green Aventurine Heart (40 mm)
Hearts
Green Aventurine Heart (40 mm)
Approximatly 40 mm in size. Hearts are a symbol of love, these make lovely little gifts: to a loved one, a bridesmaid, for yourself! These are perfect to lay on your body during a moment of pause and reflection....
£6.99
Units in Stock: 1
£6.99
Details
Add To Cart
Approximatly 40 mm in size. Hearts are a symbol of love, these make lovely little gifts: to a loved one, a bridesmaid, for yourself! These are perfect to lay on your body during a moment of pause and reflection....
Green Aventurine Pendulum
Pendulums
Green Aventurine Pendulum
Aventurine is a stone of prosperity. It reinforces leadership qualities and decisiveness. Promotes compassion and empathy. Encourages perseverance. Aventurine relieves stammers and severe neuroses. It...
£8.00
Units in Stock: 0
£8.00
Details
Add To Cart
Aventurine is a stone of prosperity. It reinforces leadership qualities and decisiveness. Promotes compassion and empathy. Encourages perseverance. Aventurine relieves stammers and severe neuroses. It...
Hematite
Tumblestones
Hematite
Hematite A stone for the mind. Focuses energy and emotions for balance between body, mind and spirit. Stengthens our connection to Earth, making us feel safe and secure. Gives Courage, strength and endurance....
£1.50
Units in Stock: 7
£1.50
Details
Add To Cart
Hematite A stone for the mind. Focuses energy and emotions for balance between body, mind and spirit. Stengthens our connection to Earth, making us feel safe and secure. Gives Courage, strength and endurance....
Howlite
Tumblestones
Howlite
Howlite Strengthens memory. Stimulates a desire for knowledge. Teaches patience and helps calm down rage, pain or stress. A calming stone, calms communication, encourages awareness and emotional expression...
£1.50
Units in Stock: 17
£1.50
Details
Add To Cart
Howlite Strengthens memory. Stimulates a desire for knowledge. Teaches patience and helps calm down rage, pain or stress. A calming stone, calms communication, encourages awareness and emotional expression...
Howlite Chip Bracelet
Howlite
Howlite Chip Bracelet
Howlite Strengthens memory. Stimulates a desire for knowledge. Teaches patience and helps calm down rage, pain or stress. A calming stone, calms communication, encourages awareness and emotional expression...
£2.00
Units in Stock: 0
£2.00
Details
Add To Cart
Howlite Strengthens memory. Stimulates a desire for knowledge. Teaches patience and helps calm down rage, pain or stress. A calming stone, calms communication, encourages awareness and emotional expression...
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i