Product Added to your Cart
x

-------- OR --------

Default
HebrewSpainJapanCzech RepublicItalyHungaryFranceRomaniaThailandPolandPolandDutchCroatiaGreeceCroatiaVietnameseGermanyFinlandDenmarkSwedenPortugalNorway
GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Menu
0 items
Crystal Corner

Please note: All crystals are handpicked and all pass my quality test, but since they are natural stones there will be some variation in appearance. If you prefer a particular one, please send a message and I’ll do my best to choose for you. The deeper tend to be more opaque; the paler tend to be clearer. You may not receive the item in the photographs.

Sub-Categories
Gemstone A-ZBraceletsHeartsPointsSoapstonesSpheresTumblestonesWorry StonesOther (mostly selenite!)
146 product(s) found for "Crystal Corner"
Moon Crystals
Crystal Corner
Moon Crystals
Embrace the mystical energy of the moon with our enchanting collection of mini crescent moon crystals. Carefully carved into the iconic crescent shape, these crystals are available in a variety of powerful...
£5.00
Units in Stock: 7
£5.00
Details
Add To Cart
Embrace the mystical energy of the moon with our enchanting collection of mini crescent moon crystals. Carefully carved into the iconic crescent shape, these crystals are available in a variety of powerful...
Moonstone
Moonstone
Moonstone
Moonstone, with its mesmerizing play of light resembling the moon's glow, is a stone that resonates with the energies of intuition and femininity. Each Moonstone Tumblestone is a unique piece of nature's...
£2.00
Units in Stock: 6
£2.00
Details
Add To Cart
Moonstone, with its mesmerizing play of light resembling the moon's glow, is a stone that resonates with the energies of intuition and femininity. Each Moonstone Tumblestone is a unique piece of nature's...
Moonstone Heart (50mm)
Moonstone
Moonstone Heart (50mm)
This crystal is approximatly 50 mm in size. Delight in the divine feminine, find your good fortune, and say yes to deeper levels of crystal healing with the powers of the Moonstone. This kaleidoscopic...
£9.90
Units in Stock: 0
£9.90
Details
Add To Cart
This crystal is approximatly 50 mm in size. Delight in the divine feminine, find your good fortune, and say yes to deeper levels of crystal healing with the powers of the Moonstone. This kaleidoscopic...
Moonstone Pendulum
Moonstone
Moonstone Pendulum
Moonstone, with its ethereal play of colors resembling the moon's glow, is a stone that resonates with the energies of intuition and femininity. Each Moonstone Pendulum is a unique work of nature, showcasing...
£8.00
Units in Stock: 3
£8.00
Details
Add To Cart
Moonstone, with its ethereal play of colors resembling the moon's glow, is a stone that resonates with the energies of intuition and femininity. Each Moonstone Pendulum is a unique work of nature, showcasing...
Moss Agate
Agate
Moss Agate
Moss Agate A stone of new beginnings. Refreshes the soul and enables you to see beauty in everything. Attracts abundance (wealth) and improves self-etseem. New ideas tend to appear out of a stagnating...
£1.50
Units in Stock: 7
£1.50
Details
Add To Cart
Moss Agate A stone of new beginnings. Refreshes the soul and enables you to see beauty in everything. Attracts abundance (wealth) and improves self-etseem. New ideas tend to appear out of a stagnating...
Mother of Pearl Chip Bracelet
Pearl
Mother of Pearl Chip Bracelet
Mother of Pearl A stone of protection brings gentle healing power of the sea. Relieves stress, helps to relax, sooth and calm emotions. Stimulates intuition, imagination, sensitivity and adaptability....
£3.00
Units in Stock: 1
£3.00
Details
Add To Cart
Mother of Pearl A stone of protection brings gentle healing power of the sea. Relieves stress, helps to relax, sooth and calm emotions. Stimulates intuition, imagination, sensitivity and adaptability....
Natural Agate Rough Cut Point
Points
Natural Agate Rough Cut Point
The raw roughness of this beautiful crystal shows you how it was compacted by the earth in the most natural way. Giving it a unique appearance it has a polished point showing you the beautiful grey natural...
£14.99
Units in Stock: 1
£14.99
Details
Add To Cart
The raw roughness of this beautiful crystal shows you how it was compacted by the earth in the most natural way. Giving it a unique appearance it has a polished point showing you the beautiful grey natural...
Obsidian
Tumblestones
Obsidian
Obsidian, born from the fiery depths of volcanic activity, is a stone that resonates with strength and resilience. Each Obsidian Tumblestone is a unique piece of nature's art, showcasing the rich, glossy...
£1.50
Units in Stock: 9
£1.50
Details
Add To Cart
Obsidian, born from the fiery depths of volcanic activity, is a stone that resonates with strength and resilience. Each Obsidian Tumblestone is a unique piece of nature's art, showcasing the rich, glossy...
Obsidian Heart (20 mm)
Hearts
Obsidian Heart (20 mm)
This crystal is approximatly 30 mm in size. Protective and perfectly poised to help you heal deeply, the Obsidian Stone is best known for keeping you in the clear when it comes to negative emotions and...
£4.00
Units in Stock: 3
£4.00
Details
Add To Cart
This crystal is approximatly 30 mm in size. Protective and perfectly poised to help you heal deeply, the Obsidian Stone is best known for keeping you in the clear when it comes to negative emotions and...
Obsidian thumbstone
Obsidian
Obsidian thumbstone
Harness the power of protection and grounding with our expertly crafted Obsidian thumbstone. This sleek, black stone is designed to fit perfectly in the curve of your thumb, making it an essential tool...
£4.00
Units in Stock: 1
£4.00
Details
Add To Cart
Harness the power of protection and grounding with our expertly crafted Obsidian thumbstone. This sleek, black stone is designed to fit perfectly in the curve of your thumb, making it an essential tool...
Opalite
Opalite
Opalite
Opalite, with its dreamy and iridescent glow, is often associated with promoting clarity of thought and enhancing communication on a spiritual level. The smooth and polished surface of these tumblestones...
£1.00
Units in Stock: 8
£1.00
Details
Add To Cart
Opalite, with its dreamy and iridescent glow, is often associated with promoting clarity of thought and enhancing communication on a spiritual level. The smooth and polished surface of these tumblestones...
Opalite Thumbstone
Opalite
Opalite Thumbstone
Discover the calming and mystical beauty of our Opalite Thumbstone, a stunning stone known for its iridescent glow and soothing energy. This thumbstone is designed to fit comfortably in your hand, making...
£4.00
Units in Stock: 2
£4.00
Details
Add To Cart
Discover the calming and mystical beauty of our Opalite Thumbstone, a stunning stone known for its iridescent glow and soothing energy. This thumbstone is designed to fit comfortably in your hand, making...
Orange coral thumbstone
Calcite
Orange coral thumbstone
Experience the vibrant energy of our Orange Coral Calcite Thumbstone, a beautifully polished crystal that combines the uplifting properties of calcite with the unique beauty of coral. This stunning thumbstone...
£5.00
Units in Stock: 2
£5.00
Details
Add To Cart
Experience the vibrant energy of our Orange Coral Calcite Thumbstone, a beautifully polished crystal that combines the uplifting properties of calcite with the unique beauty of coral. This stunning thumbstone...
Pink & Blue Aura Geode
Points
Pink & Blue Aura Geode
Display these Pink and Blue Aura Geodes in your sacred space, on your meditation altar, or any area where you seek to amplify love and positive energy. The sparkles and reflections within the geodes add...
£2.50
Units in Stock: 3
£2.50
Details
Add To Cart
Display these Pink and Blue Aura Geodes in your sacred space, on your meditation altar, or any area where you seek to amplify love and positive energy. The sparkles and reflections within the geodes add...
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i