Product Added to your Cart
x

-------- OR --------

Default
HebrewSpainJapanCzech RepublicItalyHungaryFranceRomaniaThailandPolandPolandDutchCroatiaGreeceCroatiaVietnameseGermanyFinlandDenmarkSwedenPortugalNorway
GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Menu
0 items
Crystal Corner

Please note: All crystals are handpicked and all pass my quality test, but since they are natural stones there will be some variation in appearance. If you prefer a particular one, please send a message and I’ll do my best to choose for you. The deeper tend to be more opaque; the paler tend to be clearer. You may not receive the item in the photographs.

Sub-Categories
Gemstone A-ZBraceletsHeartsPointsSoapstonesSpheresTumblestonesWorry StonesOther (mostly selenite!)
146 product(s) found for "Crystal Corner"
Pink Aragonite
Points
Pink Aragonite
Pink Aragonite, with its gentle pink hues, is a stone that resonates with the energies of emotional well-being and compassion. Each raw crystal is a unique piece of nature's art, showcasing the soft color...
£2.50
Units in Stock: 3
£2.50
Details
Add To Cart
Pink Aragonite, with its gentle pink hues, is a stone that resonates with the energies of emotional well-being and compassion. Each raw crystal is a unique piece of nature's art, showcasing the soft color...
Pink Aura Shard
Points
Pink Aura Shard
Pink Aura Quartz, created through a process of bonding gold and other minerals to natural quartz, is a stone that resonates with the energies of love and emotional well-being. Each Pink Aura Shard Crystal...
£2.00
Units in Stock: 19
£2.00
Details
Add To Cart
Pink Aura Quartz, created through a process of bonding gold and other minerals to natural quartz, is a stone that resonates with the energies of love and emotional well-being. Each Pink Aura Shard Crystal...
Plum Aventurine
Tumblestones
Plum Aventurine
Plum Aventurine, with its deep and luscious purple tones, is a stone that resonates with the energy of transformation and growth. This crystal is thought to inspire creativity, boost intuition, and encourage...
£2.00
Units in Stock: 1
£2.00
Details
Add To Cart
Plum Aventurine, with its deep and luscious purple tones, is a stone that resonates with the energy of transformation and growth. This crystal is thought to inspire creativity, boost intuition, and encourage...
Purple agate
Tumblestones
Purple agate
Purple Agate, with its rich and vibrant hues, is a stone that resonates with the energies of spirituality and heightened awareness. Each piece of Purple Agate is a unique work of nature's art, showcasing...
£1.00
Units in Stock: 7
£1.00
Details
Add To Cart
Purple Agate, with its rich and vibrant hues, is a stone that resonates with the energies of spirituality and heightened awareness. Each piece of Purple Agate is a unique work of nature's art, showcasing...
Purple Dalmation Jasper
Tumblestones
Purple Dalmation Jasper
As a stone associated with joy and spiritual grounding, Purple Dalmatian Jasper Tumblestones also make thoughtful gifts for friends, family, or anyone seeking a touch of positivity and spiritual connection....
£1.50
Units in Stock: 7
£1.50
Details
Add To Cart
As a stone associated with joy and spiritual grounding, Purple Dalmatian Jasper Tumblestones also make thoughtful gifts for friends, family, or anyone seeking a touch of positivity and spiritual connection....
Quartz Chip Bracelet
Bracelets
Quartz Chip Bracelet
Clear Quartz The Master Healer. Amplifies energy and thought as well as the effects of other crystals. Absorbs, stores, releases and regulates energy. Enhances and cleans space, self and spirit. Healing,...
£3.00
Units in Stock: 8
£3.00
Details
Add To Cart
Clear Quartz The Master Healer. Amplifies energy and thought as well as the effects of other crystals. Absorbs, stores, releases and regulates energy. Enhances and cleans space, self and spirit. Healing,...
Quartz Heart (40mm)
Hearts
Quartz Heart (40mm)
This crystal is approximatly 40 mm in size. The clear quartz stone comes from the Greek word for ice and with its glacial like appearance, pure transparency, and cooling vibes, it s no wonder that this...
£6.00
Units in Stock: 1
£6.00
Details
Add To Cart
This crystal is approximatly 40 mm in size. The clear quartz stone comes from the Greek word for ice and with its glacial like appearance, pure transparency, and cooling vibes, it s no wonder that this...
Quartz Point
Points
Quartz Point
The clear and transparent nature of quartz makes it a perfect tool for directing and amplifying energy. Our Quartz Generator Point features a pointed termination that allows the crystal to focus and project...
£9.00
Units in Stock: 1
£9.00
Details
Add To Cart
The clear and transparent nature of quartz makes it a perfect tool for directing and amplifying energy. Our Quartz Generator Point features a pointed termination that allows the crystal to focus and project...
Quartz Runes
Runes
Quartz Runes
Introducing our mesmerizing Nordic runes, meticulously carved from the pure, crystalline beauty of Clear Quartz and adorned with intricate gold symbols! These enchanting divination tools are not just crystals;...
£20.00
Units in Stock: 1
£20.00
Details
Add To Cart
Introducing our mesmerizing Nordic runes, meticulously carved from the pure, crystalline beauty of Clear Quartz and adorned with intricate gold symbols! These enchanting divination tools are not just crystals;...
Quartz Worry Stone
Clear Quartz
Quartz Worry Stone
Approximatly 40 mm in size. Worry stones are smooth, polished gemstones, usually an oval with thumb sized indentations, used for relaxation or anxiety relief. Rubbing a worry stone can help releve tension...
£4.50
Units in Stock: 2
£4.50
Details
Add To Cart
Approximatly 40 mm in size. Worry stones are smooth, polished gemstones, usually an oval with thumb sized indentations, used for relaxation or anxiety relief. Rubbing a worry stone can help releve tension...
Rainbow Moonstone Chip Brace..
Moonstone
Rainbow Moonstone Chip Brace..
Moonstone A stone for new beginnings. Inner strength and growth. Soothes emotional instability and stress, giving calmness. Enhances intuition. Brings good fortune in love and business! Abundance, Nurturing,...
£4.00
Units in Stock: 9
£4.00
Details
Add To Cart
Moonstone A stone for new beginnings. Inner strength and growth. Soothes emotional instability and stress, giving calmness. Enhances intuition. Brings good fortune in love and business! Abundance, Nurturing,...
Red Fire Aura Shards
Crystal Corner
Red Fire Aura Shards
Flame aura quartz is one of the highest vibrational crystals with intense positive energy that are used to enhance spiritual well-being. This powerful gemstone is very useful during deep meditation and...
£2.50
Units in Stock: 19
£2.50
Details
Add To Cart
Flame aura quartz is one of the highest vibrational crystals with intense positive energy that are used to enhance spiritual well-being. This powerful gemstone is very useful during deep meditation and...
Red Jasper Pendulum
Pendulums
Red Jasper Pendulum
Daring, delicate and the dreamiest shade of fire red, red jasper is one of those stones that screams energy right down to its very core. Beautifully aligned with the root chakra, Red Jasper may look like...
£7.00
Units in Stock: 1
£7.00
Details
Add To Cart
Daring, delicate and the dreamiest shade of fire red, red jasper is one of those stones that screams energy right down to its very core. Beautifully aligned with the root chakra, Red Jasper may look like...
Red Jasper Thumbstone
Jasper
Red Jasper Thumbstone
Ground yourself with the protective and empowering energy of our Red Jasper Thumbstone, a beautifully polished stone known for its rich, earthy red tones and powerful metaphysical properties. This thumbstone...
£4.00
Units in Stock: 1
£4.00
Details
Add To Cart
Ground yourself with the protective and empowering energy of our Red Jasper Thumbstone, a beautifully polished stone known for its rich, earthy red tones and powerful metaphysical properties. This thumbstone...
Red Jasper Worry Stone
Jasper
Red Jasper Worry Stone
Embrace the grounding energy and nurturing warmth of our Red Jasper Heart-Shaped Worry Stone, a beautifully carved piece designed to bring comfort, strength, and emotional balance into your life. Shaped...
£5.00
Units in Stock: 1
£5.00
Details
Add To Cart
Embrace the grounding energy and nurturing warmth of our Red Jasper Heart-Shaped Worry Stone, a beautifully carved piece designed to bring comfort, strength, and emotional balance into your life. Shaped...
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i