Product Added to your Cart
x

-------- OR --------

Default
HebrewSpainJapanCzech RepublicItalyHungaryFranceRomaniaThailandPolandPolandDutchCroatiaGreeceCroatiaVietnameseGermanyFinlandDenmarkSwedenPortugalNorway
GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Menu
0 items
Crystal Corner

Please note: All crystals are handpicked and all pass my quality test, but since they are natural stones there will be some variation in appearance. If you prefer a particular one, please send a message and I’ll do my best to choose for you. The deeper tend to be more opaque; the paler tend to be clearer. You may not receive the item in the photographs.

Sub-Categories
Gemstone A-ZBraceletsHeartsPointsSoapstonesSpheresTumblestonesWorry StonesOther (mostly selenite!)
146 product(s) found for "Crystal Corner"
Rhodonite
Rhodonite
Rhodonite
Rhodonite is also said to encourage love of all kinds, including love for yourself, in relationships, and in terms of group cooperation. Some people use rhodonite for anxiety and panic attacks, and others...
£1.50
Units in Stock: 7
£1.50
Details
Add To Cart
Rhodonite is also said to encourage love of all kinds, including love for yourself, in relationships, and in terms of group cooperation. Some people use rhodonite for anxiety and panic attacks, and others...
Rhodonite Chip Bracelet
Rhodonite
Rhodonite Chip Bracelet
Rhodonite A stone of compassion, emotional balancer that clears away wounds and scars from the past, nurtures love. Grounds energy, balances yin-yang aids in achieving highest potential. Calm, Inner path,...
£3.00
Units in Stock: 1
£3.00
Details
Add To Cart
Rhodonite A stone of compassion, emotional balancer that clears away wounds and scars from the past, nurtures love. Grounds energy, balances yin-yang aids in achieving highest potential. Calm, Inner path,...
Rose Quartz
Rose Quartz
Rose Quartz
Incorporate Rose Quartz into your daily life to promote self-love and compassion. Whether you're a crystal enthusiast or new to the world of healing stones, these tumble stones are a versatile and beautiful...
£1.00
Units in Stock: 9
£1.00
Details
Add To Cart
Incorporate Rose Quartz into your daily life to promote self-love and compassion. Whether you're a crystal enthusiast or new to the world of healing stones, these tumble stones are a versatile and beautiful...
Rose Quartz Chip Bracelet
Rose Quartz
Rose Quartz Chip Bracelet
Rose Quartz The crystal of love. Encourages unconditional love, restores trust and harmony. Purifies and opens the heart up to all levels of love. Encourages self-forgiveness, self-trust and self-worth....
£2.00
Units in Stock: 3
£2.00
Details
Add To Cart
Rose Quartz The crystal of love. Encourages unconditional love, restores trust and harmony. Purifies and opens the heart up to all levels of love. Encourages self-forgiveness, self-trust and self-worth....
Rose Quartz Oval Pendulum
Rose Quartz
Rose Quartz Oval Pendulum
Introducing our Rose Quartz Pendulum with a Tree of Life Chain a beautifully crafted and spiritually infused tool that merges the loving energy of rose quartz with the profound symbolism of the Tree of...
£8.00
Units in Stock: 2
£8.00
Details
Add To Cart
Introducing our Rose Quartz Pendulum with a Tree of Life Chain a beautifully crafted and spiritually infused tool that merges the loving energy of rose quartz with the profound symbolism of the Tree of...
Rose Quartz Pendulum
Rose Quartz
Rose Quartz Pendulum
Introducing our Rose Quartz Pendulum a beautifully crafted and spiritually resonant tool that combines the gentle energy of rose quartz with the ancient art of pendulum divination. Elevate your spiritual...
£7.00
Units in Stock: 1
£7.00
Details
Add To Cart
Introducing our Rose Quartz Pendulum a beautifully crafted and spiritually resonant tool that combines the gentle energy of rose quartz with the ancient art of pendulum divination. Elevate your spiritual...
Rose Quartz Point
Rose Quartz
Rose Quartz Point
Rose Quartz, with its delicate pink hues, is a stone that resonates with the energies of love and emotional well-being. Each Rose Quartz Point is a unique work of nature, showcasing the soft color variations...
£8.00
Units in Stock: 0
£8.00
Details
Add To Cart
Rose Quartz, with its delicate pink hues, is a stone that resonates with the energies of love and emotional well-being. Each Rose Quartz Point is a unique work of nature, showcasing the soft color variations...
Rose Quartz Rough Cut Point
Rose Quartz
Rose Quartz Rough Cut Point
The raw roughness of this beautiful crystal shows you how it was compacted by the earth in the most natural way. Giving it a unique appearance it has a polished point showing you the beautiful Pink Rose...
£15.00
Units in Stock: 1
£15.00
Details
Add To Cart
The raw roughness of this beautiful crystal shows you how it was compacted by the earth in the most natural way. Giving it a unique appearance it has a polished point showing you the beautiful Pink Rose...
Selenite Bowl 8 cm
Selenite
Selenite Bowl 8 cm
Weighty Selenite Bowl approx. 8 cm in diameter. A small bowl! Selenite Provides clarity of the mind, expanding the self-awareness and of your surroundings. Opens up the crown and higher crown chakras and...
£15.00
Units in Stock: 1
£15.00
Details
Add To Cart
Weighty Selenite Bowl approx. 8 cm in diameter. A small bowl! Selenite Provides clarity of the mind, expanding the self-awareness and of your surroundings. Opens up the crown and higher crown chakras and...
Selenite Chakra Ingot
Selenite
Selenite Chakra Ingot
Introducing our 10 cm Selenite Ingot, intricately etched with the seven chakras. This beautifully crafted piece combines the natural radiance of selenite with the profound symbolism of the chakras, making...
£10.00
Units in Stock: 1
£10.00
Details
Add To Cart
Introducing our 10 cm Selenite Ingot, intricately etched with the seven chakras. This beautifully crafted piece combines the natural radiance of selenite with the profound symbolism of the chakras, making...
Selenite Charging Plate (9 cm)
Selenite
Selenite Charging Plate (9 cm)
Large Selenite Circular Charging Plate. Approx. 9 cm across. Selenite has some known varieties: desert rose, satin spar and gypsum flower. It comes in pale shades of pearly white with a clay like texture....
£10.00
Units in Stock: 2
£10.00
Details
Add To Cart
Large Selenite Circular Charging Plate. Approx. 9 cm across. Selenite has some known varieties: desert rose, satin spar and gypsum flower. It comes in pale shades of pearly white with a clay like texture....
Selenite Hexaganol Lotus Disc
Selenite
Selenite Hexaganol Lotus Disc
Introducing our Selenite Hexagonal Disc, a beautifully crafted piece measuring 8 cm wide, featuring a delicately etched lotus design. This elegant disc combines the natural beauty of selenite with the...
£7.00
Units in Stock: 0
£7.00
Details
Add To Cart
Introducing our Selenite Hexagonal Disc, a beautifully crafted piece measuring 8 cm wide, featuring a delicately etched lotus design. This elegant disc combines the natural beauty of selenite with the...
Selenite mini tower
Selenite
Selenite mini tower
Selenite mini tower. Approx. 6cm long. Many use crystal towers to focus energy into the body and the room/area they are working in. Towers point and concentrate the energy, selenite is a high-vibrational...
£3.50
Units in Stock: 1
£3.50
Details
Add To Cart
Selenite mini tower. Approx. 6cm long. Many use crystal towers to focus energy into the body and the room/area they are working in. Towers point and concentrate the energy, selenite is a high-vibrational...
Selenite Moon 6-7 cm
Selenite
Selenite Moon 6-7 cm
Weighty Selenite Small Circular Charging Plate. Approx. 6.5 cm across. Etched with 12 zodiac symbols and pentacle. Selenite has some known varieties: desert rose, satin spar and gypsum flower. It comes...
£10.00
Units in Stock: 2
£10.00
Details
Add To Cart
Weighty Selenite Small Circular Charging Plate. Approx. 6.5 cm across. Etched with 12 zodiac symbols and pentacle. Selenite has some known varieties: desert rose, satin spar and gypsum flower. It comes...
Selenite Pendulum
Selenite
Selenite Pendulum
Unlock the power of clarity and intuition with our exquisite Selenite Pendulum. Known for its ethereal beauty and powerful metaphysical properties, this pendulum is an essential tool for divination, energy...
£8.00
Units in Stock: 0
£8.00
Details
Add To Cart
Unlock the power of clarity and intuition with our exquisite Selenite Pendulum. Known for its ethereal beauty and powerful metaphysical properties, this pendulum is an essential tool for divination, energy...
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i