Product Added to your Cart
x

-------- OR --------

Default
HebrewSpainJapanCzech RepublicItalyHungaryFranceRomaniaThailandPolandPolandDutchCroatiaGreeceCroatiaVietnameseGermanyFinlandDenmarkSwedenPortugalNorway
GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Menu
0 items
Crystal Corner

Please note: All crystals are handpicked and all pass my quality test, but since they are natural stones there will be some variation in appearance. If you prefer a particular one, please send a message and I’ll do my best to choose for you. The deeper tend to be more opaque; the paler tend to be clearer. You may not receive the item in the photographs.

Sub-Categories
Gemstone A-ZBraceletsHeartsPointsSoapstonesSpheresTumblestonesWorry StonesOther (mostly selenite!)
146 product(s) found for "Crystal Corner"
Selenite pointed wand 11 cm
Selenite
Selenite pointed wand 11 cm
Selenite Spiral Wand. Approx. 10 cm long. Many use crystal wands to cleanse their body and the room/area they are working in. Wands point and concentrate the energy, selenite is a high-vibrational energy...
£6.00
Units in Stock: 0
£6.00
Details
Add To Cart
Selenite Spiral Wand. Approx. 10 cm long. Many use crystal wands to cleanse their body and the room/area they are working in. Wands point and concentrate the energy, selenite is a high-vibrational energy...
Selenite Tree of Life Disc 9cm
Selenite
Selenite Tree of Life Disc 9cm
Introducing our Circular Selenite Disc, measuring 8 cm wide and featuring a beautifully etched Tree of Life design. This exquisite piece combines the natural radiance of selenite with the profound symbolism...
£12.00
Units in Stock: 0
£12.00
Details
Add To Cart
Introducing our Circular Selenite Disc, measuring 8 cm wide and featuring a beautifully etched Tree of Life design. This exquisite piece combines the natural radiance of selenite with the profound symbolism...
Selenite Zodiac Disc 9 cm
Selenite
Selenite Zodiac Disc 9 cm
Introducing our Circular Selenite Disc, measuring 8 cm wide and intricately etched with the twelve zodiac signs. This stunning piece combines the natural luminescence of selenite with the mystique of astrology,...
£12.00
Units in Stock: 1
£12.00
Details
Add To Cart
Introducing our Circular Selenite Disc, measuring 8 cm wide and intricately etched with the twelve zodiac signs. This stunning piece combines the natural luminescence of selenite with the mystique of astrology,...
Small Rose Quartz Soapstone
Soapstones
Small Rose Quartz Soapstone
Embrace the gentle, loving energy of our Rose Quartz Soapstone, a beautifully polished stone renowned for its soft pink hue and powerful metaphysical properties. Whether used in meditation, as a calming...
£6.00
Units in Stock: 1
£6.00
Details
Add To Cart
Embrace the gentle, loving energy of our Rose Quartz Soapstone, a beautifully polished stone renowned for its soft pink hue and powerful metaphysical properties. Whether used in meditation, as a calming...
Smoky Quartz
Smokey Quartz
Smoky Quartz
Some say that smoky quartz works best in the winter months, when the days are shorter and the sun's warmth is harder to find. You can place pieces of smoky quartz in areas of your home that contain electronic...
£1.50
Units in Stock: 7
£1.50
Details
Add To Cart
Some say that smoky quartz works best in the winter months, when the days are shorter and the sun's warmth is harder to find. You can place pieces of smoky quartz in areas of your home that contain electronic...
Smoky Quartz Bracelet
Smokey Quartz
Smoky Quartz Bracelet
Smokey Quartz Excellent grounding stone. Neutralises negative vibrations, dispels fear, lifts depression and negativity. Emotional calmness in anxiety and stress. Positive thoughts and actions. Aids concentration...
£3.00
Units in Stock: 9
£3.00
Details
Add To Cart
Smokey Quartz Excellent grounding stone. Neutralises negative vibrations, dispels fear, lifts depression and negativity. Emotional calmness in anxiety and stress. Positive thoughts and actions. Aids concentration...
Smoky Quartz Pendulum
Smokey Quartz
Smoky Quartz Pendulum
The color of midnight cloud beneath a full moon, Smoky Quartz seems to capture all the enigmatic delight of the mystical world but its true strength sits in its powerful grounding properties. Ever ready...
£8.00
Units in Stock: 1
£8.00
Details
Add To Cart
The color of midnight cloud beneath a full moon, Smoky Quartz seems to capture all the enigmatic delight of the mystical world but its true strength sits in its powerful grounding properties. Ever ready...
Snowflake Obsidian
Tumblestones
Snowflake Obsidian
This Stone is known to help your shift patterns and comes with soothing vibes for frayed nerves. A beautiful flurry of white can be seen against the stark contrast of black.
£1.50
Units in Stock: 8
£1.50
Details
Add To Cart
This Stone is known to help your shift patterns and comes with soothing vibes for frayed nerves. A beautiful flurry of white can be seen against the stark contrast of black.
Snowflake Obsidian Chip Brac..
Obsidian
Snowflake Obsidian Chip Brac..
Snowflake Obsidian Calming and soothing. Tells you to value mistakes as well as success. Provides balance to body mind and spirit. Helps with meditation and letting go stressful mental patterns Soothing,...
£2.00
Units in Stock: 8
£2.00
Details
Add To Cart
Snowflake Obsidian Calming and soothing. Tells you to value mistakes as well as success. Provides balance to body mind and spirit. Helps with meditation and letting go stressful mental patterns Soothing,...
Sodalite
Sodalite
Sodalite
Sodalite, with its deep blue hues and characteristic white veins, is known as the "Stone of Logic." It is believed to enhance rational thinking, stimulate mental clarity, and encourage open communication....
£1.50
Units in Stock: 13
£1.50
Details
Add To Cart
Sodalite, with its deep blue hues and characteristic white veins, is known as the "Stone of Logic." It is believed to enhance rational thinking, stimulate mental clarity, and encourage open communication....
Sodalite Bracelet
Sodalite
Sodalite Bracelet
Sodalite, with its deep blue hues and characteristic white veins, is known as the "Stone of Logic." It is believed to enhance rational thinking, stimulate mental clarity, and encourage open communication....
£1.50
Units in Stock: 10
£1.50
Details
Add To Cart
Sodalite, with its deep blue hues and characteristic white veins, is known as the "Stone of Logic." It is believed to enhance rational thinking, stimulate mental clarity, and encourage open communication....
Sodalite Heart 20 mm
Hearts
Sodalite Heart 20 mm
Celebrate the beauty of friendship and emotional balance with our stunning 20 mm Sodalite Heart Crystals. These charming heart-shaped stones are not only visually captivating but also packed with powerful...
£4.00
Units in Stock: 3
£4.00
Details
Add To Cart
Celebrate the beauty of friendship and emotional balance with our stunning 20 mm Sodalite Heart Crystals. These charming heart-shaped stones are not only visually captivating but also packed with powerful...
Striped Agate
Tumblestones
Striped Agate
stunning large Red, Orange, and White Striped Agate tumblestone, a captivating piece sourced from the rich mineral deposits of Madagascar. This natural beauty showcases vibrant bands of fiery red, warm...
£5.00
Units in Stock: 2
£5.00
Details
Add To Cart
stunning large Red, Orange, and White Striped Agate tumblestone, a captivating piece sourced from the rich mineral deposits of Madagascar. This natural beauty showcases vibrant bands of fiery red, warm...
Sunset Aura Quartz Sphere
Aura Quartz
Sunset Aura Quartz Sphere
Formed with titanium, silver and other trace elements. Displays orange & magenta. Sunsets are the embodiment of beautiful transitions. It gives you a cue that every ending has a new beginning. It clears...
£3.50
Units in Stock: 4
£3.50
Details
Add To Cart
Formed with titanium, silver and other trace elements. Displays orange & magenta. Sunsets are the embodiment of beautiful transitions. It gives you a cue that every ending has a new beginning. It clears...
Sunstone Chip Bracelet
Sunstone
Sunstone Chip Bracelet
Sunstone Linked to luck and good fortune. It clears and energies all the chakras. Brings about good nature. Allows the real self to shine through. Encourages originality. Self-empowerment, Enthusiasm,...
£4.00
Units in Stock: 1
£4.00
Details
Add To Cart
Sunstone Linked to luck and good fortune. It clears and energies all the chakras. Brings about good nature. Allows the real self to shine through. Encourages originality. Self-empowerment, Enthusiasm,...
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i